Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03643.1.g00090.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 251aa    MW: 27982.9 Da    PI: 5.0406
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+WT+eEd +lv  v+++G ++W+  a+  g++Rt+k+c++rw +yl  5 KGSWTEEEDAQLVWFVRLFGERRWDFLAKVSGLKRTGKSCRLRWVNYL 52
                                  799*******************************************97 PP

               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   rgr T++E+ l+v++++++G++ W++Iar ++ gRt++++k++w++  58 RGRITADEERLIVELHAKWGSR-WSRIARSLP-GRTDNEIKNFWRT 101
                                   899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.405156IPR017930Myb domain
SMARTSM007173.9E-13454IPR001005SANT/Myb domain
PfamPF002491.8E-13552IPR001005SANT/Myb domain
CDDcd001674.23E-10752No hitNo description
PROSITE profilePS5129419.65157107IPR017930Myb domain
SMARTSM007172.4E-1457105IPR001005SANT/Myb domain
PfamPF002493.9E-1458101IPR001005SANT/Myb domain
CDDcd001671.81E-1062101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-2651064104C-Myb DNA-Binding Domain
1msf_C3e-2651064104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660308.11e-102PREDICTED: transcription factor MYB59-like
TrEMBLK3ZD381e-102K3ZD38_SETIT; Uncharacterized protein
STRINGSi024470m1e-101(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number